 Friends links |
|
| Picture |
Heading |
Updated |
 |
Fish Feed, 42% Protein
Model Number: YT006
Brand Name: YATAI
Key Specifications/Special Features:
Fish feed 42% ProteinSpecifications:1. Crude protein: 28% min2. Pass SGS, PONY test3. Ash: 8% max4. Melamine: freeFunctions and use:1. Is quality protein ingredients, a... |
2017-09-09 |
 |
Catfish Food
Model Number: Catfish Food
Brand Name: YATAI
Key Specifications/Special Features:
Fish foodProtein: 30% minMoisture: 8% maxAsh: 12% maxCrude fiber: 12% maxAppearance: brown yellowPacking: 25kg/bag, PP bags with PE linersLoading quantity:1*20''... |
2017-09-01 |
 |
High Quality Floating Fish Feed Pellet for Catfish
Model Number: animal feed
Brand Name: yatai
Key Specifications/Special Features:
Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat... |
2017-07-02 |
|
